![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.50: dsRBD-like [54767] (5 superfamilies) alpha-beta(3)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) ![]() |
![]() | Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins) Pfam PF00035 |
![]() | Protein automated matches [191157] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255423] (1 PDB entry) |
![]() | Domain d2lbsb1: 2lbs B:366-453 [242835] Other proteins in same PDB: d2lbsb2 automated match to d1t4lb_ protein/RNA complex |
PDB Entry: 2lbs (more details)
SCOPe Domain Sequences for d2lbsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lbsb1 d.50.1.1 (B:366-453) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikiagi raaenalrdkkmldfyakqraaiprses
Timeline for d2lbsb1: