Lineage for d2lbsb1 (2lbs B:366-453)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946839Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2946840Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2946841Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. 2946913Protein automated matches [191157] (3 species)
    not a true protein
  7. 2946914Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255423] (1 PDB entry)
  8. 2946915Domain d2lbsb1: 2lbs B:366-453 [242835]
    Other proteins in same PDB: d2lbsb2
    automated match to d1t4lb_
    protein/RNA complex

Details for d2lbsb1

PDB Entry: 2lbs (more details)

PDB Description: Solution structure of double-stranded RNA binding domain of S. cerevisiae RNase III (Rnt1p) in complex with AAGU tetraloop hairpin
PDB Compounds: (B:) Ribonuclease 3

SCOPe Domain Sequences for d2lbsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lbsb1 d.50.1.1 (B:366-453) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikiagi
raaenalrdkkmldfyakqraaiprses

SCOPe Domain Coordinates for d2lbsb1:

Click to download the PDB-style file with coordinates for d2lbsb1.
(The format of our PDB-style files is described here.)

Timeline for d2lbsb1: