SCOPe 2.05: Domain d2lbna_: 2lbn A:

Lineage for d2lbna_ (2lbn A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.9: Neurophysin II [49605] (1 superfamily)
   sandwich; 8 strands in 2 sheets; meander

4. Superfamily b.9.1: Neurophysin II [49606] (1 family)
   duplication: composed of two structural repeats
   automatically mapped to Pfam PF00184

5. Family b.9.1.1: Neurophysin II [49607] (1 protein)

6. Protein Neurophysin II [49608] (1 species)
   can be classified as disulfide-rich

7. Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)

8. Domain d2lbna_: 2lbn A: [242834]
   automated match to d1l5da_
   mutant

Details for d2lbna_

PDB Entry: 2lbn

PDB Description: (Revised) Solution structure of the monomeric form of a mutant unliganded bovine neurophysin, 20 structures

PDB Compounds: (A:) neurophysin 1

SCOPe Domain Sequences for d2lbna_:

Sequence; same for both SEQRES and ATOM records:

>d2lbna_ b.9.1.1 (A:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
avldldvrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccspdgceedpacdpeaafs

Timeline for d2lbna_:

• d2lbna_ first appeared in SCOPe 2.04
  
• d2lbna_ appears in SCOPe 2.06
  
• d2lbna_ appears in the current release, SCOPe 2.08