| Class b: All beta proteins [48724] (176 folds) |
| Fold b.9: Neurophysin II [49605] (1 superfamily) sandwich; 8 strands in 2 sheets; meander |
Superfamily b.9.1: Neurophysin II [49606] (1 family) ![]() duplication: composed of two structural repeats automatically mapped to Pfam PF00184 |
| Family b.9.1.1: Neurophysin II [49607] (1 protein) |
| Protein Neurophysin II [49608] (1 species) can be classified as disulfide-rich |
| Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries) |
| Domain d2lbhb_: 2lbh B: [242833] automated match to d1l5da_ |
PDB Entry: 2lbh (more details)
SCOPe Domain Sequences for d2lbhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lbhb_ b.9.1.1 (B:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
avldldvrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccspdgchedpacdpeaafs
Timeline for d2lbhb_: