Lineage for d2lbhb_ (2lbh B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529651Fold b.9: Neurophysin II [49605] (1 superfamily)
    sandwich; 8 strands in 2 sheets; meander
  4. 1529652Superfamily b.9.1: Neurophysin II [49606] (1 family) (S)
    duplication: composed of two structural repeats
    automatically mapped to Pfam PF00184
  5. 1529653Family b.9.1.1: Neurophysin II [49607] (1 protein)
  6. 1529654Protein Neurophysin II [49608] (1 species)
    can be classified as disulfide-rich
  7. 1529655Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)
  8. 1529681Domain d2lbhb_: 2lbh B: [242833]
    automated match to d1l5da_

Details for d2lbhb_

PDB Entry: 2lbh (more details)

PDB Description: Solution Structure of the Dimeric Form of a Unliganded Bovine Neurophysin, Minimized Average Structure
PDB Compounds: (B:) neurophysin 1

SCOPe Domain Sequences for d2lbhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lbhb_ b.9.1.1 (B:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
avldldvrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccspdgchedpacdpeaafs

SCOPe Domain Coordinates for d2lbhb_:

Click to download the PDB-style file with coordinates for d2lbhb_.
(The format of our PDB-style files is described here.)

Timeline for d2lbhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2lbha_