SCOPe 2.08: Domain d2lbhb_: 2lbh B:

Lineage for d2lbhb_ (2lbh B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.9: Neurophysin II [49605] (1 superfamily)
   sandwich; 8 strands in 2 sheets; meander

4. Superfamily b.9.1: Neurophysin II [49606] (1 family)
   duplication: composed of two structural repeats
   automatically mapped to Pfam PF00184

5. Family b.9.1.1: Neurophysin II [49607] (1 protein)

6. Protein Neurophysin II [49608] (1 species)
   can be classified as disulfide-rich

7. Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)

8. Domain d2lbhb_: 2lbh B: [242833]
   automated match to d1l5da_

Details for d2lbhb_

PDB Entry: 2lbh

PDB Description: Solution Structure of the Dimeric Form of a Unliganded Bovine Neurophysin, Minimized Average Structure

PDB Compounds: (B:) neurophysin 1

SCOPe Domain Sequences for d2lbhb_:

Sequence; same for both SEQRES and ATOM records:

>d2lbhb_ b.9.1.1 (B:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
avldldvrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgqkp
cgsggrcaaagiccspdgchedpacdpeaafs

Timeline for d2lbhb_:

• d2lbhb_ first appeared in SCOPe 2.04
  
• d2lbhb_ appears in SCOPe 2.07