Lineage for d2lbba_ (2lbb A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482120Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1482121Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) (S)
  5. 1482142Family a.11.1.0: automated matches [191596] (1 protein)
    not a true family
  6. 1482143Protein automated matches [191086] (4 species)
    not a true protein
  7. 1482144Species Babesia bovis [TaxId:5865] [255422] (1 PDB entry)
  8. 1482145Domain d2lbba_: 2lbb A: [242831]
    automated match to d1hbka_

Details for d2lbba_

PDB Entry: 2lbb (more details)

PDB Description: Solution structure of acyl CoA binding protein from Babesia bovis T2Bo
PDB Compounds: (A:) Acyl CoA binding protein

SCOPe Domain Sequences for d2lbba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lbba_ a.11.1.0 (A:) automated matches {Babesia bovis [TaxId: 5865]}
msaddfdaavkyvsntttmmasnddklcfykyykqatvgdcnkpkpgmlqlqekykweaw
nalrgmstesakeayvklldtlapswrn

SCOPe Domain Coordinates for d2lbba_:

Click to download the PDB-style file with coordinates for d2lbba_.
(The format of our PDB-style files is described here.)

Timeline for d2lbba_: