Class a: All alpha proteins [46456] (285 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.1: Acyl-CoA binding protein [47027] (2 families) |
Family a.11.1.0: automated matches [191596] (1 protein) not a true family |
Protein automated matches [191086] (4 species) not a true protein |
Species Babesia bovis [TaxId:5865] [255422] (1 PDB entry) |
Domain d2lbba_: 2lbb A: [242831] automated match to d1hbka_ |
PDB Entry: 2lbb (more details)
SCOPe Domain Sequences for d2lbba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lbba_ a.11.1.0 (A:) automated matches {Babesia bovis [TaxId: 5865]} msaddfdaavkyvsntttmmasnddklcfykyykqatvgdcnkpkpgmlqlqekykweaw nalrgmstesakeayvklldtlapswrn
Timeline for d2lbba_: