Lineage for d1dy4a_ (1dy4 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374492Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 protein domains)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2374493Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species)
  7. 2374526Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (21 PDB entries)
  8. 2374549Domain d1dy4a_: 1dy4 A: [24283]
    complexed with co, nag, snp

Details for d1dy4a_

PDB Entry: 1dy4 (more details), 1.9 Å

PDB Description: cbh1 in complex with s-propranolol
PDB Compounds: (A:) exoglucanase 1

SCOPe Domain Sequences for d1dy4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dy4a_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOPe Domain Coordinates for d1dy4a_:

Click to download the PDB-style file with coordinates for d1dy4a_.
(The format of our PDB-style files is described here.)

Timeline for d1dy4a_: