Lineage for d2lb9a1 (2lb9 A:31-200)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576707Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2576708Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2576758Protein Sensor protein CYB2465 [160659] (2 species)
  7. 2576759Species Synechococcus sp. [TaxId:1131] [160660] (4 PDB entries)
    Uniprot Q2JIZ5 31-200
  8. 2576760Domain d2lb9a1: 2lb9 A:31-200 [242829]
    Other proteins in same PDB: d2lb9a2
    automated match to d2k2na1
    complexed with cyc

Details for d2lb9a1

PDB Entry: 2lb9 (more details)

PDB Description: Refined solution structure of a cyanobacterial phytochrome gaf domain in the red light-absorbing ground state (corrected pyrrole ring planarity)
PDB Compounds: (A:) sensor histidine kinase

SCOPe Domain Sequences for d2lb9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lb9a1 d.110.2.1 (A:31-200) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]}
ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqael

SCOPe Domain Coordinates for d2lb9a1:

Click to download the PDB-style file with coordinates for d2lb9a1.
(The format of our PDB-style files is described here.)

Timeline for d2lb9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lb9a2