SCOPe 2.05: Domain d2lagb2: 2lag B:110-212

Lineage for d2lagb2 (2lag B:110-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (27 PDB entries)

8. Domain d2lagb2: 2lag B:110-212 [242825]
   Other proteins in same PDB: d2laga_
   automated match to d2hyma2

Details for d2lagb2

PDB Entry: 2lag

PDB Description: Structure of the 44 kDa complex of interferon-alpha2 with the extracellular part of IFNAR2 obtained by 2D-double difference NOESY

PDB Compounds: (B:) Interferon alpha/beta receptor 2

SCOPe Domain Sequences for d2lagb2:

Sequence; same for both SEQRES and ATOM records:

>d2lagb2 b.1.2.1 (B:110-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pefeivgftnhinvmvkfpsiveeelqfdlslvieeqsegivkkhkpeikgnmsgnftyi
idklipntnycvsvylehsdeqaviksplkctllppgqesefs

Timeline for d2lagb2:

• d2lagb2 first appeared in SCOPe 2.04
  
• d2lagb2 appears in SCOPe 2.06
  
• d2lagb2 appears in the current release, SCOPe 2.08