SCOPe 2.05: Domain d2la6a_: 2la6 A:

Lineage for d2la6a_ (2la6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (74 PDB entries)

8. Domain d2la6a_: 2la6 A: [242822]
   automated match to d2cpea1

Details for d2la6a_

PDB Entry: 2la6

PDB Description: Solution NMR Structure of RRM domain of RNA-binding protein FUS from homo sapiens, Northeast Structural Genomics Consortium Target HR6430A

PDB Compounds: (A:) RNA-binding protein FUS

SCOPe Domain Sequences for d2la6a_:

Sequence; same for both SEQRES and ATOM records:

>d2la6a_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mghhhhhhshsdnntifvqglgenvtiesvadyfkqigiiktnkktgqpminlytdretg
klkgeatvsfddppsakaaidwfdgkefsgnpikvsfat

Timeline for d2la6a_:

• d2la6a_ first appeared in SCOPe 2.04
  
• d2la6a_ is called d2la6a1 in SCOPe 2.06
  
• d2la6a_ appears in the current release, SCOPe 2.08, called d2la6a1