SCOPe 2.07: Domain d2la4a1: 2la4 A:315-414

Lineage for d2la4a1 (2la4 A:315-414)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries)

8. Domain d2la4a1: 2la4 A:315-414 [242821]
   Other proteins in same PDB: d2la4a2
   automated match to d1x4ga1

Details for d2la4a1

PDB Entry: 2la4

PDB Description: NMR structure of the C-terminal RRM domain of poly(U) binding 1

PDB Compounds: (A:) Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1

SCOPe Domain Sequences for d2la4a1:

Sequence; same for both SEQRES and ATOM records:

>d2la4a1 d.58.7.0 (A:315-414) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sqtiglppqvnpqavdhiirsapprvttayigniphfateadliplfqnfgfildfkhyp
ekgccfikydtheqaavcivalanfpfqgrnlrtgwgker

Timeline for d2la4a1:

• d2la4a1 first appeared in SCOPe 2.04, called d2la4a_
  
• d2la4a1 appears in SCOPe 2.06