SCOPe 2.07: Domain d2l9sb1: 2l9s B:295-385

Lineage for d2l9sb1 (2l9s B:295-385)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.59: PAH2 domain [47761] (1 superfamily)
   4 helices; open up-and-down bundle; binds alpha-helical peptides

4. Superfamily a.59.1: PAH2 domain [47762] (1 family)

5. Family a.59.1.1: PAH2 domain [47763] (3 protein domains)

6. Protein automated matches [254596] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255420] (1 PDB entry)

8. Domain d2l9sb1: 2l9s B:295-385 [242820]
   Other proteins in same PDB: d2l9sb2
   automated match to d1s5qb_

Details for d2l9sb1

PDB Entry: 2l9s

PDB Description: Solution structure of Pf1 SID1-mSin3A PAH2 Complex

PDB Compounds: (B:) Paired amphipathic helix protein Sin3a

SCOPe Domain Sequences for d2l9sb1:

Sequence; same for both SEQRES and ATOM records:

>d2l9sb1 a.59.1.1 (B:295-385) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
slqnnqpvefnhainyvnkiknrfqgqpdiykafleilhtyqkeqrnakeaggnytpalt
eqevyaqvarlfknqedllsefgqflpdans

Timeline for d2l9sb1:

• d2l9sb1 first appeared in SCOPe 2.04, called d2l9sb_
  
• d2l9sb1 appears in SCOPe 2.06