Lineage for d2l9sb1 (2l9s B:295-385)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715406Fold a.59: PAH2 domain [47761] (1 superfamily)
    4 helices; open up-and-down bundle; binds alpha-helical peptides
  4. 2715407Superfamily a.59.1: PAH2 domain [47762] (1 family) (S)
  5. 2715408Family a.59.1.1: PAH2 domain [47763] (3 proteins)
  6. 2715422Protein automated matches [254596] (2 species)
    not a true protein
  7. 2715425Species Mouse (Mus musculus) [TaxId:10090] [255420] (1 PDB entry)
  8. 2715426Domain d2l9sb1: 2l9s B:295-385 [242820]
    Other proteins in same PDB: d2l9sb2
    automated match to d1s5qb_

Details for d2l9sb1

PDB Entry: 2l9s (more details)

PDB Description: Solution structure of Pf1 SID1-mSin3A PAH2 Complex
PDB Compounds: (B:) Paired amphipathic helix protein Sin3a

SCOPe Domain Sequences for d2l9sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l9sb1 a.59.1.1 (B:295-385) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
slqnnqpvefnhainyvnkiknrfqgqpdiykafleilhtyqkeqrnakeaggnytpalt
eqevyaqvarlfknqedllsefgqflpdans

SCOPe Domain Coordinates for d2l9sb1:

Click to download the PDB-style file with coordinates for d2l9sb1.
(The format of our PDB-style files is described here.)

Timeline for d2l9sb1: