![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.59: PAH2 domain [47761] (1 superfamily) 4 helices; open up-and-down bundle; binds alpha-helical peptides |
![]() | Superfamily a.59.1: PAH2 domain [47762] (1 family) ![]() |
![]() | Family a.59.1.1: PAH2 domain [47763] (3 proteins) |
![]() | Protein automated matches [254596] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255420] (1 PDB entry) |
![]() | Domain d2l9sb1: 2l9s B:295-385 [242820] Other proteins in same PDB: d2l9sb2 automated match to d1s5qb_ |
PDB Entry: 2l9s (more details)
SCOPe Domain Sequences for d2l9sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l9sb1 a.59.1.1 (B:295-385) automated matches {Mouse (Mus musculus) [TaxId: 10090]} slqnnqpvefnhainyvnkiknrfqgqpdiykafleilhtyqkeqrnakeaggnytpalt eqevyaqvarlfknqedllsefgqflpdans
Timeline for d2l9sb1: