SCOPe 2.05: Domain d2l9la_: 2l9l A:

Lineage for d2l9la_ (2l9l A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255419] (1 PDB entry)

8. Domain d2l9la_: 2l9l A: [242819]
   automated match to d1d7pm_

Details for d2l9la_

PDB Entry: 2l9l

PDB Description: NMR Structure of the Mouse MFG-E8 C2 Domain

PDB Compounds: (A:) Lactadherin

SCOPe Domain Sequences for d2l9la_:

Sequence; same for both SEQRES and ATOM records:

>d2l9la_ b.18.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mksghgcseplglknntipdsqmsasssyktwnlrafgwyphlgrldnqgkinawtaqsn
sakewlqvdlgtqrqvtgiitqgardfghiqyvasykvahsddgvqwtvyeeqgsskvfq
gnldnnshkknifekpfmaryvrvlpvswhnritlrlellgcle

Timeline for d2l9la_:

• d2l9la_ first appeared in SCOPe 2.04
  
• d2l9la_ is called d2l9la1 in SCOPe 2.06
  
• d2l9la_ appears in the current release, SCOPe 2.08, called d2l9la1