SCOPe 2.07: Domain d2l9hc_: 2l9h C:

Lineage for d2l9hc_ (2l9h C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)

6. Protein RANTES (regulated upon activation, normal T-cell expressed and secreted) [54132] (1 species)
   has different dimerisation mode

7. Species Human (Homo sapiens) [TaxId:9606] [54133] (15 PDB entries)
   Uniprot P13501 25-91

8. Domain d2l9hc_: 2l9h C: [242817]
   automated match to d1rtoa_

Details for d2l9hc_

PDB Entry: 2l9h

PDB Description: oligomeric structure of the chemokine ccl5/rantes from nmr, ms, and saxs data

PDB Compounds: (C:) c-c motif chemokine 5

SCOPe Domain Sequences for d2l9hc_:

Sequence; same for both SEQRES and ATOM records:

>d2l9hc_ d.9.1.1 (C:) RANTES (regulated upon activation, normal T-cell expressed and secreted) {Human (Homo sapiens) [TaxId: 9606]}
pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
inslems

Timeline for d2l9hc_:

• d2l9hc_ first appeared in SCOPe 2.04
  
• d2l9hc_ appears in SCOPe 2.06