Lineage for d2l98a1 (2l98 A:91-161)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711123Protein Troponin C [47503] (6 species)
  7. 2711158Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (28 PDB entries)
  8. 2711181Domain d2l98a1: 2l98 A:91-161 [242813]
    Other proteins in same PDB: d2l98a2
    automated match to d1ozsa_
    complexed with ca, stl

    fragment; missing more than one-third of the common structure and/or sequence

Details for d2l98a1

PDB Entry: 2l98 (more details)

PDB Description: Structure of trans-Resveratrol in complex with the cardiac regulatory protein Troponin C
PDB Compounds: (A:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d2l98a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l98a1 a.39.1.5 (A:91-161) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
gkseeelsdlfrmfdknadgyidldelkimlqatgetiteddieelmkdgdknndgridy
deflefmkgve

SCOPe Domain Coordinates for d2l98a1:

Click to download the PDB-style file with coordinates for d2l98a1.
(The format of our PDB-style files is described here.)

Timeline for d2l98a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2l98a2