SCOPe 2.08: Domain d2l93a1: 2l93 A:91-137

Lineage for d2l93a1 (2l93 A:91-137)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.155: H-NS histone-like proteins [81274] (1 superfamily)
   multihelical oligomeric protein; structure of whole subunit is not known yet but are probably composed of three different domains

4. Superfamily a.155.1: H-NS histone-like proteins [81273] (1 family)
   available NMR structures suggest two very different dimerisation modes of the N-terminal domain

5. Family a.155.1.1: H-NS histone-like proteins [81272] (3 proteins)

6. Protein automated matches [254595] (2 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [255418] (1 PDB entry)

8. Domain d2l93a1: 2l93 A:91-137 [242812]
   Other proteins in same PDB: d2l93a2
   automated match to d1hnra_

Details for d2l93a1

PDB Entry: 2l93

PDB Description: Solution structure of the C-terminal domain of Salmonella H-NS

PDB Compounds: (A:) dna-binding protein h-ns

SCOPe Domain Sequences for d2l93a1:

Sequence; same for both SEQRES and ATOM records:

>d2l93a1 a.155.1.1 (A:91-137) automated matches {Salmonella typhimurium [TaxId: 90371]}
aarpakysyvdengetktwtgqgrtpavikkameeqgkqledflike

Timeline for d2l93a1:

• d2l93a1 first appeared in SCOPe 2.04, called d2l93a_
  
• d2l93a1 appears in SCOPe 2.07