Lineage for d2l90a_ (2l90 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954739Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954740Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)
  6. 2954741Protein Peptide methionine sulfoxide reductase [55070] (4 species)
  7. 2954751Species Mouse (Mus musculus) [TaxId:10090] [255417] (2 PDB entries)
  8. 2954753Domain d2l90a_: 2l90 A: [242811]
    automated match to d1fvab_
    complexed with myr

Details for d2l90a_

PDB Entry: 2l90 (more details)

PDB Description: Solution structure of murine myristoylated msrA
PDB Compounds: (A:) peptide methionine sulfoxide reductase

SCOPe Domain Sequences for d2l90a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l90a_ d.58.28.1 (A:) Peptide methionine sulfoxide reductase {Mouse (Mus musculus) [TaxId: 10090]}
gdsaskvisaeealpgrtepipvtakhhvsgnrtvepfpegtqmavfgmgcfwgaerkfw
vlkgvystqvgfagghtrnptykevcsektghaevvrvvyrpehisfeellkvfwenhdp
tqgmrqgndfgtqyrsavyptsavqmeaalrskeeyqkvlskhnfgpittdiregqvfyy
aedyhqqylsknpdgycglggtgvscpmaikk

SCOPe Domain Coordinates for d2l90a_:

Click to download the PDB-style file with coordinates for d2l90a_.
(The format of our PDB-style files is described here.)

Timeline for d2l90a_: