| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
| Family b.34.9.1: Tudor domain [63749] (8 proteins) Pfam PF00567 |
| Protein Lamin-b receptor [141209] (2 species) |
| Species Chicken (Gallus gallus) [TaxId:9031] [255414] (1 PDB entry) |
| Domain d2l8da1: 2l8d A:5-66 [242807] Other proteins in same PDB: d2l8da2 automated match to d2diga1 |
PDB Entry: 2l8d (more details)
SCOPe Domain Sequences for d2l8da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l8da1 b.34.9.1 (A:5-66) Lamin-b receptor {Chicken (Gallus gallus) [TaxId: 9031]}
mpnrkyadgevvmgrwpgsvlyyevqvtsyddashlytvkykdgtelalkesdirlqssf
kq
Timeline for d2l8da1: