SCOPe 2.04: Domain d2l8aa_: 2l8a A:

Lineage for d2l8aa_ (2l8a A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (6 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [255415] (1 PDB entry)

8. Domain d2l8aa_: 2l8a A: [242806]
   automated match to d4b97a_

Details for d2l8aa_

PDB Entry: 2l8a

PDB Description: Structure of a novel CBM3 lacking the calcium-binding site

PDB Compounds: (A:) endoglucanase

SCOPe Domain Sequences for d2l8aa_:

Sequence; same for both SEQRES and ATOM records:

>d2l8aa_ b.2.2.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
masisvqyragdgsmnsnqirpqlqiknngnttvdlkdvtarywykaknkgqnfdcdyaq
igcgnvthkfvtlhkpkqgadtylelgfkngtlapgastgniqlrlhnddwsnyaqsgdy
sffksntfkttkkitlydqgkliwgtepn

Timeline for d2l8aa_:

• d2l8aa_ is new in SCOPe 2.04-stable
  
• d2l8aa_ appears in SCOPe 2.05
  
• d2l8aa_ appears in the current release, SCOPe 2.08, called d2l8aa1