![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) ![]() |
![]() | Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
![]() | Protein automated matches [191113] (13 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [255415] (1 PDB entry) |
![]() | Domain d2l8aa1: 2l8a A:354-499 [242806] Other proteins in same PDB: d2l8aa2 automated match to d4b97a_ |
PDB Entry: 2l8a (more details)
SCOPe Domain Sequences for d2l8aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l8aa1 b.2.2.0 (A:354-499) automated matches {Bacillus subtilis [TaxId: 1423]} isvqyragdgsmnsnqirpqlqiknngnttvdlkdvtarywykaknkgqnfdcdyaqigc gnvthkfvtlhkpkqgadtylelgfkngtlapgastgniqlrlhnddwsnyaqsgdysff ksntfkttkkitlydqgkliwgtepn
Timeline for d2l8aa1: