Lineage for d2l89a_ (2l89 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784802Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2784803Protein automated matches [191144] (3 species)
    not a true protein
  7. 2784804Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [255413] (1 PDB entry)
  8. 2784805Domain d2l89a_: 2l89 A: [242805]
    automated match to d1h3za_

Details for d2l89a_

PDB Entry: 2l89 (more details)

PDB Description: Solution structure of Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA
PDB Compounds: (A:) PWWP domain-containing protein 1

SCOPe Domain Sequences for d2l89a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l89a_ b.34.9.0 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
saddrlnfgdrilvkapgypwwpalllrrketkdslntnssfnvlykvlffpdfnfawvk
rnsvkplldseiakflgsskrkskelieayeasktppdlkeesstdle

SCOPe Domain Coordinates for d2l89a_:

Click to download the PDB-style file with coordinates for d2l89a_.
(The format of our PDB-style files is described here.)

Timeline for d2l89a_: