Class g: Small proteins [56992] (98 folds) |
Fold g.44: RING/U-box [57849] (1 superfamily) dimetal(zinc)-bound alpha+beta motif; structurally diverse |
Superfamily g.44.1: RING/U-box [57850] (7 families) |
Family g.44.1.5: Zf-UBP [161204] (4 proteins) Pfam PF02148 |
Protein automated matches [254594] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255412] (3 PDB entries) |
Domain d2l80a_: 2l80 A: [242802] automated match to d2g45a_ complexed with zn |
PDB Entry: 2l80 (more details)
SCOPe Domain Sequences for d2l80a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l80a_ g.44.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vskyannltqldngvrippsgwkcarcdlrenlwlnltdgsvlcgkwffdssggnghale hyrdmgyplavklgtitpdgadvysfqeeepvldphlakhlahfgidmlhmhgt
Timeline for d2l80a_: