Lineage for d2l80a_ (2l80 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037640Family g.44.1.5: Zf-UBP [161204] (4 proteins)
    Pfam PF02148
  6. 3037664Protein automated matches [254594] (1 species)
    not a true protein
  7. 3037665Species Human (Homo sapiens) [TaxId:9606] [255412] (2 PDB entries)
  8. 3037666Domain d2l80a_: 2l80 A: [242802]
    automated match to d2g45a_
    complexed with zn

Details for d2l80a_

PDB Entry: 2l80 (more details)

PDB Description: Solution Structure of the Zinc Finger Domain of USP13
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 13

SCOPe Domain Sequences for d2l80a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l80a_ g.44.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vskyannltqldngvrippsgwkcarcdlrenlwlnltdgsvlcgkwffdssggnghale
hyrdmgyplavklgtitpdgadvysfqeeepvldphlakhlahfgidmlhmhgt

SCOPe Domain Coordinates for d2l80a_:

Click to download the PDB-style file with coordinates for d2l80a_.
(The format of our PDB-style files is described here.)

Timeline for d2l80a_: