Lineage for d2l7za1 (2l7z A:7-73)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2306149Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2306150Protein automated matches [190674] (25 species)
    not a true protein
  7. 2306215Species Human (Homo sapiens) [TaxId:9606] [189258] (28 PDB entries)
  8. 2306246Domain d2l7za1: 2l7z A:7-73 [242801]
    Other proteins in same PDB: d2l7za2
    automated match to d1qrya_

Details for d2l7za1

PDB Entry: 2l7z (more details)

PDB Description: NMR Structure of A13 homedomain
PDB Compounds: (A:) Homeobox protein Hox-A13

SCOPe Domain Sequences for d2l7za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l7za1 a.4.1.0 (A:7-73) automated matches {Human (Homo sapiens) [TaxId: 9606]}
grkkrvpytkvqlkelereyatnkfitkdkrrrisattnlserqvtiwfqnrrvkekkvi
nklktts

SCOPe Domain Coordinates for d2l7za1:

Click to download the PDB-style file with coordinates for d2l7za1.
(The format of our PDB-style files is described here.)

Timeline for d2l7za1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2l7za2