| Class b: All beta proteins [48724] (180 folds) |
| Fold b.17: PEBP-like [49776] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.17.1: PEBP-like [49777] (3 families) ![]() |
| Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins) |
| Protein automated matches [190720] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255411] (1 PDB entry) |
| Domain d2l7wa_: 2l7w A: [242800] automated match to d2iqya_ |
PDB Entry: 2l7w (more details)
SCOPe Domain Sequences for d2l7wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l7wa_ b.17.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpvdlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdglds
gklytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhry
vwlvyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpkl
yeqlsgk
Timeline for d2l7wa_: