Lineage for d2l7wa_ (2l7w A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774037Fold b.17: PEBP-like [49776] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2774038Superfamily b.17.1: PEBP-like [49777] (3 families) (S)
  5. 2774039Family b.17.1.1: Phosphatidylethanolamine binding protein [49778] (4 proteins)
  6. 2774063Protein automated matches [190720] (3 species)
    not a true protein
  7. 2774064Species Human (Homo sapiens) [TaxId:9606] [255411] (1 PDB entry)
  8. 2774065Domain d2l7wa_: 2l7w A: [242800]
    automated match to d2iqya_

Details for d2l7wa_

PDB Entry: 2l7w (more details)

PDB Description: Solution structure of the human Raf-1 kinase inhibitor protein
PDB Compounds: (A:) Phosphatidylethanolamine-binding protein 1

SCOPe Domain Sequences for d2l7wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l7wa_ b.17.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpvdlskwsgplslqevdeqpqhplhvtyagaavdelgkvltptqvknrptsiswdglds
gklytlvltdpdapsrkdpkyrewhhflvvnmkgndissgtvlsdyvgsgppkgtglhry
vwlvyeqdrplkcdepilsnrsgdhrgkfkvasfrkkyelrapvagtcyqaewddyvpkl
yeqlsgk

SCOPe Domain Coordinates for d2l7wa_:

Click to download the PDB-style file with coordinates for d2l7wa_.
(The format of our PDB-style files is described here.)

Timeline for d2l7wa_: