SCOPe 2.06: Domain d2l7mp1: 2l7m P:1-66

Lineage for d2l7mp1 (2l7m P:1-66)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189258] (25 PDB entries)

8. Domain d2l7mp1: 2l7m P:1-66 [242798]
   Other proteins in same PDB: d2l7mp2
   automated match to d1bw5a_
   mutant

Details for d2l7mp1

PDB Entry: 2l7m

PDB Description: Solution Structure of the Pitx2 Homeodomain R24H mutant

PDB Compounds: (P:) Pituitary homeobox 2

SCOPe Domain Sequences for d2l7mp1:

Sequence; same for both SEQRES and ATOM records:

>d2l7mp1 a.4.1.0 (P:1-66) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrrqrthftsqqlqeleatfqrnhypdmstreeiavwtnltearvrvwfknrrakwrkre
efivtd

Timeline for d2l7mp1:

• d2l7mp1 first appeared in SCOPe 2.04, called d2l7mp_
  
• d2l7mp1 was called d2l7mp_ in SCOPe 2.05
  
• d2l7mp1 appears in SCOPe 2.07
  
• d2l7mp1 appears in the current release, SCOPe 2.08