SCOPe 2.08: Domain d2l6aa1: 2l6a A:3-100

Lineage for d2l6aa1 (2l6a A:3-100)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.0: automated matches [254238] (1 protein)
   not a true family

6. Protein automated matches [254542] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255408] (6 PDB entries)

8. Domain d2l6aa1: 2l6a A:3-100 [242787]
   Other proteins in same PDB: d2l6aa2, d2l6aa3
   automated match to d1pn5a1

Details for d2l6aa1

PDB Entry: 2l6a

PDB Description: three-dimensional structure of the n-terminal effector pyrin domain of nlrp12

PDB Compounds: (A:) NACHT, LRR and PYD domains-containing protein 12

SCOPe Domain Sequences for d2l6aa1:

Sequence; same for both SEQRES and ATOM records:

>d2l6aa1 a.77.1.0 (A:3-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlrtagrdglcrlstyleeleavelkkfklylgtatelgegkipwgsmekagplemaqll
ithfgpeeawrlalstferinrkdlwergqredlvrdt

Timeline for d2l6aa1:

• d2l6aa1 first appeared in SCOPe 2.04, called d2l6aa_
  
• d2l6aa1 appears in SCOPe 2.07