| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
| Family a.77.1.0: automated matches [254238] (1 protein) not a true family |
| Protein automated matches [254542] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255408] (6 PDB entries) |
| Domain d2l6aa1: 2l6a A:3-100 [242787] Other proteins in same PDB: d2l6aa2, d2l6aa3 automated match to d1pn5a1 |
PDB Entry: 2l6a (more details)
SCOPe Domain Sequences for d2l6aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l6aa1 a.77.1.0 (A:3-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mlrtagrdglcrlstyleeleavelkkfklylgtatelgegkipwgsmekagplemaqll
ithfgpeeawrlalstferinrkdlwergqredlvrdt
Timeline for d2l6aa1: