Lineage for d2l5xd_ (2l5x D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2791606Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2791924Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2792014Protein automated matches [190999] (1 species)
    not a true protein
  7. 2792015Species Human (Homo sapiens) [TaxId:9606] [188735] (17 PDB entries)
  8. 2792041Domain d2l5xd_: 2l5x D: [242784]
    Other proteins in same PDB: d2l5xb_, d2l5xc_
    automated match to d2ilaa_

Details for d2l5xd_

PDB Entry: 2l5x (more details)

PDB Description: solution structure of il1a-s100a13 complex
PDB Compounds: (D:) interleukin-1 alpha

SCOPe Domain Sequences for d2l5xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l5xd_ b.42.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nvkynfmriikyefilndalnqsiirandqyltaaalhnldeavkfdmgayksskddaki
tvilrisktqlyvtaqdedqpvllkempeipktitgsetnllffwethgtknyftsvahp
nlfiatkqdywvclaggppsitdfqilenqa

SCOPe Domain Coordinates for d2l5xd_:

Click to download the PDB-style file with coordinates for d2l5xd_.
(The format of our PDB-style files is described here.)

Timeline for d2l5xd_: