SCOPe 2.08: Domain d2l5ua1: 2l5u A:6-61

Lineage for d2l5ua1 (2l5u A:6-61)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein Mi2-beta (CHD4) [90226] (1 species)
   chromodomain-helicase-DNA-binding protein 4

7. Species Human (Homo sapiens) [TaxId:9606] [90227] (3 PDB entries)

8. Domain d2l5ua1: 2l5u A:6-61 [242780]
   Other proteins in same PDB: d2l5ua2
   automated match to d1mm2a_
   complexed with zn

Details for d2l5ua1

PDB Entry: 2l5u

PDB Description: Structure of the first PHD finger (PHD1) from CHD4 (Mi2b)

PDB Compounds: (A:) Chromodomain-helicase-DNA-binding protein 4

SCOPe Domain Sequences for d2l5ua1:

Sequence; same for both SEQRES and ATOM records:

>d2l5ua1 g.50.1.2 (A:6-61) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]}
yetdhqdycevcqqggeiilcdtcprayhmvcldpdmekapegkwscphcekegiq

Timeline for d2l5ua1:

• d2l5ua1 first appeared in SCOPe 2.04, called d2l5ua_
  
• d2l5ua1 appears in SCOPe 2.07