![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
![]() | Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
![]() | Protein automated matches [254572] (2 species) not a true protein |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [255407] (1 PDB entry) |
![]() | Domain d2l5ta_: 2l5t A: [242779] automated match to d1laca_ |
PDB Entry: 2l5t (more details)
SCOPe Domain Sequences for d2l5ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l5ta_ b.84.1.1 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]} myefklpdigegvtegeivrwdvkegdmvekdqdlvevmtdkvtvkipspvrgkivkily regqvvpvgstllqidt
Timeline for d2l5ta_: