SCOPe 2.08: Domain d2l5oa1: 2l5o A:1-142

Lineage for d2l5oa1 (2l5o A:1-142)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:491] [196523] (3 PDB entries)

8. Domain d2l5oa1: 2l5o A:1-142 [242777]
   Other proteins in same PDB: d2l5oa2
   automated match to d4ka0b_

Details for d2l5oa1

PDB Entry: 2l5o

PDB Description: solution structure of a putative thioredoxin from neisseria meningitidis

PDB Compounds: (A:) putative thioredoxin

SCOPe Domain Sequences for d2l5oa1:

Sequence; same for both SEQRES and ATOM records:

>d2l5oa1 c.47.1.0 (A:1-142) automated matches {Neisseria meningitidis [TaxId: 491]}
dsktapafslpdlhgktvsnadlqgkvtlinfwfpscpgcvsempkiiktandyknknfq
vlavaqpidpiesvrqyvkdyglpftvmydadkavgqafgtqvyptsvligkkgeilkty
vgepdfgklyqeidtawrnsda

Timeline for d2l5oa1:

• d2l5oa1 first appeared in SCOPe 2.04, called d2l5oa_
  
• d2l5oa1 appears in SCOPe 2.07