SCOPe 2.05: Domain d2l5la_: 2l5l A:

Lineage for d2l5la_ (2l5l A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Bacteroides vulgatus [TaxId:435590] [194549] (5 PDB entries)

8. Domain d2l5la_: 2l5l A: [242776]
   automated match to d4gwrb_

Details for d2l5la_

PDB Entry: 2l5l

PDB Description: solution structure of thioredoxin from bacteroides vulgatus

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2l5la_:

Sequence; same for both SEQRES and ATOM records:

>d2l5la_ c.47.1.0 (A:) automated matches {Bacteroides vulgatus [TaxId: 435590]}
mslategngkvihltkaeflakvynfeknpeewkyegdkpaivdfyadwcgpckmvapil
delakeydgqiviykvdtekeqelagafgirsipsilfipmegkpemaqgampkasfkka
idefllkkeghhhhhh

Timeline for d2l5la_:

• d2l5la_ first appeared in SCOPe 2.04
  
• d2l5la_ is called d2l5la1 in SCOPe 2.06
  
• d2l5la_ appears in the current release, SCOPe 2.08, called d2l5la1