Lineage for d2l54a_ (2l54 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693367Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 2693400Protein automated matches [190680] (2 species)
    not a true protein
  7. 2693401Species Human (Homo sapiens) [TaxId:9606] [225893] (3 PDB entries)
  8. 2693410Domain d2l54a_: 2l54 A: [242774]
    automated match to d1qbjc_
    mutant

Details for d2l54a_

PDB Entry: 2l54 (more details)

PDB Description: Solution structure of the Zalpha domain mutant of ADAR1 (N43A,Y47A)
PDB Compounds: (A:) Double-stranded RNA-specific adenosine deaminase

SCOPe Domain Sequences for d2l54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l54a_ a.4.5.19 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yqdqeqrilkfleelgegkattahdlsgklgtpkkeiarvlaslakkgklqkeagtpplw
kia

SCOPe Domain Coordinates for d2l54a_:

Click to download the PDB-style file with coordinates for d2l54a_.
(The format of our PDB-style files is described here.)

Timeline for d2l54a_: