SCOPe 2.07: Domain d2l51a_: 2l51 A:

Lineage for d2l51a_ (2l51 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (56 PDB entries)

8. Domain d2l51a_: 2l51 A: [242771]
   automated match to d3nxaa_
   complexed with ca

Details for d2l51a_

PDB Entry: 2l51

PDB Description: solution structure of calcium bound s100a16

PDB Compounds: (A:) Protein S100-A16

SCOPe Domain Sequences for d2l51a_:

Sequence; same for both SEQRES and ATOM records:

>d2l51a_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdcytelekavivlvenfykyvskyslvknkiskssfremlqkelnhmlsdtgnrkaadk
liqnldanhdgrisfdeywtliggitgpiakliheqeqqsss

Timeline for d2l51a_:

• d2l51a_ first appeared in SCOPe 2.04
  
• d2l51a_ appears in SCOPe 2.06
  
• d2l51a_ appears in the current release, SCOPe 2.08