Lineage for d1sll_1 (1sll 81-276)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 108955Family b.29.1.9: Leech intramolecular trans-sialidase, N-terminal domain [49968] (1 protein)
  6. 108956Protein Leech intramolecular trans-sialidase, N-terminal domain [49969] (1 species)
  7. 108957Species North american leech (Macrobdella decora) [TaxId:6405] [49970] (5 PDB entries)
  8. 108962Domain d1sll_1: 1sll 81-276 [24277]
    Other proteins in same PDB: d1sll_2

Details for d1sll_1

PDB Entry: 1sll (more details), 2 Å

PDB Description: sialidase l from leech macrobdella decora

SCOP Domain Sequences for d1sll_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sll_1 b.29.1.9 (81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora)}
ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns
tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa
nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn
alsdeeliqatgvtty

SCOP Domain Coordinates for d1sll_1:

Click to download the PDB-style file with coordinates for d1sll_1.
(The format of our PDB-style files is described here.)

Timeline for d1sll_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sll_2