Lineage for d2l50a_ (2l50 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1734668Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1734669Protein automated matches [190513] (27 species)
    not a true protein
  7. 1734713Species Human (Homo sapiens) [TaxId:9606] [189519] (38 PDB entries)
  8. 1734771Domain d2l50a_: 2l50 A: [242769]
    automated match to d3nxaa_

Details for d2l50a_

PDB Entry: 2l50 (more details)

PDB Description: solution structure of apo s100a16
PDB Compounds: (A:) Protein S100-A16

SCOPe Domain Sequences for d2l50a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l50a_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdcytelekavivlvenfykyvskyslvknkiskssfremlqkelnhmlsdtgnrkaadk
liqnldanhdgrisfdeywtliggitgpiakliheqeqqsss

SCOPe Domain Coordinates for d2l50a_:

Click to download the PDB-style file with coordinates for d2l50a_.
(The format of our PDB-style files is described here.)

Timeline for d2l50a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2l50b_