Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries) |
Domain d2l50a_: 2l50 A: [242769] automated match to d3nxaa_ |
PDB Entry: 2l50 (more details)
SCOPe Domain Sequences for d2l50a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l50a_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sdcytelekavivlvenfykyvskyslvknkiskssfremlqkelnhmlsdtgnrkaadk liqnldanhdgrisfdeywtliggitgpiakliheqeqqsss
Timeline for d2l50a_: