Lineage for d2l4qa_ (2l4q A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880020Species Mycobacterium tuberculosis [TaxId:1773] [187835] (4 PDB entries)
  8. 2880024Domain d2l4qa_: 2l4q A: [242764]
    automated match to d3o6tb_

Details for d2l4qa_

PDB Entry: 2l4q (more details)

PDB Description: solution structures of oxidized and reduced thioredoxin c from m. tb
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2l4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l4qa_ c.47.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtdseksatikvtdasfatdvlssnkpvlvdfwatwcgpckmvapvleeiateratdltv
akldvdtnpetarnfqvvsiptlilfkdgqpvkrivgakgkaallrelsdvvpnln

SCOPe Domain Coordinates for d2l4qa_:

Click to download the PDB-style file with coordinates for d2l4qa_.
(The format of our PDB-style files is described here.)

Timeline for d2l4qa_: