Lineage for d2l4na_ (2l4n A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499233Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2499234Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2499623Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2499624Protein automated matches [190775] (3 species)
    not a true protein
  7. 2499625Species Human (Homo sapiens) [TaxId:9606] [188003] (11 PDB entries)
  8. 2499649Domain d2l4na_: 2l4n A: [242763]
    automated match to d1bo0a_

Details for d2l4na_

PDB Entry: 2l4n (more details)

PDB Description: solution structure of the chemokine ccl21
PDB Compounds: (A:) C-C motif chemokine 21

SCOPe Domain Sequences for d2l4na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l4na_ d.9.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdggaqdcclkysqrkipakvvrsyrkqepslgcsipailflprkrsqaelcadpkelwv
qqlmqhldkt

SCOPe Domain Coordinates for d2l4na_:

Click to download the PDB-style file with coordinates for d2l4na_.
(The format of our PDB-style files is described here.)

Timeline for d2l4na_: