Lineage for d2l4la_ (2l4l A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036238Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 3036239Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 3036240Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)
  6. 3036268Protein Zinc finger protein ncp10 [57765] (3 species)
  7. 3036269Species Human immunodeficiency virus 1 [TaxId:11676] [256394] (1 PDB entry)
  8. 3036270Domain d2l4la_: 2l4l A: [242762]
    automated match to d2exfa1
    protein/DNA complex; complexed with zn

Details for d2l4la_

PDB Entry: 2l4l (more details)

PDB Description: Structural insights into the cTAR DNA recognition by the HIV-1 Nucleocapsid protein: role of sugar deoxyriboses in the binding polarity of NC
PDB Compounds: (A:) HIV-1 nucleocapsid protein NCp7

SCOPe Domain Sequences for d2l4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l4la_ g.40.1.1 (A:) Zinc finger protein ncp10 {Human immunodeficiency virus 1 [TaxId: 11676]}
knvkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterqan

SCOPe Domain Coordinates for d2l4la_:

Click to download the PDB-style file with coordinates for d2l4la_.
(The format of our PDB-style files is described here.)

Timeline for d2l4la_: