![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily) metal(zinc)-bound fold |
![]() | Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) ![]() |
![]() | Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins) |
![]() | Protein Zinc finger protein ncp10 [57765] (3 species) |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [256394] (1 PDB entry) |
![]() | Domain d2l4la_: 2l4l A: [242762] automated match to d2exfa1 protein/DNA complex; complexed with zn |
PDB Entry: 2l4l (more details)
SCOPe Domain Sequences for d2l4la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l4la_ g.40.1.1 (A:) Zinc finger protein ncp10 {Human immunodeficiency virus 1 [TaxId: 11676]} knvkcfncgkeghtarncraprkkgcwkcgkeghqmkdcterqan
Timeline for d2l4la_: