Lineage for d2l3ya_ (2l3y A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705910Family a.26.1.0: automated matches [194949] (1 protein)
    not a true family
  6. 2705911Protein automated matches [194950] (3 species)
    not a true protein
  7. 2705915Species Mouse (Mus musculus) [TaxId:10090] [255403] (2 PDB entries)
  8. 2705916Domain d2l3ya_: 2l3y A: [242757]
    automated match to d4ni9a_

Details for d2l3ya_

PDB Entry: 2l3y (more details)

PDB Description: Solution structure of mouse IL-6
PDB Compounds: (A:) interleukin-6

SCOPe Domain Sequences for d2l3ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l3ya_ a.26.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sqvrrgdftedttpnrpvyttsqvgglithvlweivemrkelcngnsdcmnnddalaenn
lklpeiqrndgcyqtgynqeicllkissglleyhsyleymknnlkdnkkdkarvlqrdte
tlihifnqevkdlhkivlptpisnalltdklesqkewlrtktiqfilksleeflkvtlrs
trqt

SCOPe Domain Coordinates for d2l3ya_:

Click to download the PDB-style file with coordinates for d2l3ya_.
(The format of our PDB-style files is described here.)

Timeline for d2l3ya_: