Class a: All alpha proteins [46456] (290 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.0: automated matches [194949] (1 protein) not a true family |
Protein automated matches [194950] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [255403] (2 PDB entries) |
Domain d2l3ya_: 2l3y A: [242757] automated match to d4ni9a_ |
PDB Entry: 2l3y (more details)
SCOPe Domain Sequences for d2l3ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l3ya_ a.26.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} sqvrrgdftedttpnrpvyttsqvgglithvlweivemrkelcngnsdcmnnddalaenn lklpeiqrndgcyqtgynqeicllkissglleyhsyleymknnlkdnkkdkarvlqrdte tlihifnqevkdlhkivlptpisnalltdklesqkewlrtktiqfilksleeflkvtlrs trqt
Timeline for d2l3ya_: