Lineage for d2l3xa_ (2l3x A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725340Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 1725341Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) (S)
  5. 1725375Family a.14.1.0: automated matches [254251] (1 protein)
    not a true family
  6. 1725376Protein automated matches [254571] (1 species)
    not a true protein
  7. 1725377Species Human (Homo sapiens) [TaxId:9606] [255323] (3 PDB entries)
  8. 1725378Domain d2l3xa_: 2l3x A: [242756]
    automated match to d1yu5x_

Details for d2l3xa_

PDB Entry: 2l3x (more details)

PDB Description: villin head piece domain of human ABLIM2
PDB Compounds: (A:) ABLIM2 protein

SCOPe Domain Sequences for d2l3xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l3xa_ a.14.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qykiypydslivtnrirvklpkdvdrtrlerhlspeefqevfgmsieefdrlalwkrndl
kkkallf

SCOPe Domain Coordinates for d2l3xa_:

Click to download the PDB-style file with coordinates for d2l3xa_.
(The format of our PDB-style files is described here.)

Timeline for d2l3xa_: