Class a: All alpha proteins [46456] (285 folds) |
Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily) 3 short helices; irregular array |
Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) |
Family a.14.1.0: automated matches [254251] (1 protein) not a true family |
Protein automated matches [254571] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255323] (3 PDB entries) |
Domain d2l3xa_: 2l3x A: [242756] automated match to d1yu5x_ |
PDB Entry: 2l3x (more details)
SCOPe Domain Sequences for d2l3xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l3xa_ a.14.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qykiypydslivtnrirvklpkdvdrtrlerhlspeefqevfgmsieefdrlalwkrndl kkkallf
Timeline for d2l3xa_: