![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.18: SWIRM domain [140222] (4 proteins) Pfam PF04433; contains extra N-terminal helix |
![]() | Protein automated matches [254593] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255400] (1 PDB entry) |
![]() | Domain d2l3da1: 2l3d A:3-102 [242753] Other proteins in same PDB: d2l3da2 automated match to d2coma1 |
PDB Entry: 2l3d (more details)
SCOPe Domain Sequences for d2l3da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l3da1 a.4.1.18 (A:3-102) automated matches {Human (Homo sapiens) [TaxId: 9606]} vegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltfea tlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl
Timeline for d2l3da1: