SCOPe 2.08: Domain d2l3da1: 2l3d A:3-102

Lineage for d2l3da1 (2l3d A:3-102)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.18: SWIRM domain [140222] (4 proteins)
   Pfam PF04433; contains extra N-terminal helix

6. Protein automated matches [254593] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255400] (1 PDB entry)

8. Domain d2l3da1: 2l3d A:3-102 [242753]
   Other proteins in same PDB: d2l3da2
   automated match to d2coma1

Details for d2l3da1

PDB Entry: 2l3d

PDB Description: The solution structure of the short form SWIRM domain of LSD1

PDB Compounds: (A:) Lysine-specific histone demethylase 1A

SCOPe Domain Sequences for d2l3da1:

Sequence; same for both SEQRES and ATOM records:

>d2l3da1 a.4.1.18 (A:3-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltfea
tlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

Timeline for d2l3da1:

• d2l3da1 first appeared in SCOPe 2.04, called d2l3da_
  
• d2l3da1 appears in SCOPe 2.07