Class b: All beta proteins [48724] (176 folds) |
Fold b.97: Cytolysin/lectin [63723] (1 superfamily) sandwich, 10 strands in 2 sheets; |
Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) some topological similarity to osmotin |
Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins) Pfam PF06369 |
Protein Sticholysin II [89268] (1 species) |
Species Carribean sea anemone (Stoichactis helianthus) [TaxId:6123] [89269] (5 PDB entries) |
Domain d2l38a_: 2l38 A: [242750] automated match to d1gwya_ mutant |
PDB Entry: 2l38 (more details)
SCOPe Domain Sequences for d2l38a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l38a_ b.97.1.1 (A:) Sticholysin II {Carribean sea anemone (Stoichactis helianthus) [TaxId: 6123]} alagtiiagasltfqvldkvleelgkvsqkiavgidnesggtwtalnayfrsgttdvilp efvpntkallysgrkdtgpvatgavaafayymssgntlgvmfsvpfdynwysnwwdvkiy sgkrradqgmyedlyygnpyrgdngwheknlgyglrmkgimtsageakmqikisr
Timeline for d2l38a_: