Lineage for d4sli_1 (4sli 81-276)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460479Family b.29.1.9: Leech intramolecular trans-sialidase, N-terminal domain [49968] (1 protein)
  6. 460480Protein Leech intramolecular trans-sialidase, N-terminal domain [49969] (1 species)
  7. 460481Species North american leech (Macrobdella decora) [TaxId:6405] [49970] (5 PDB entries)
  8. 460483Domain d4sli_1: 4sli 81-276 [24275]
    Other proteins in same PDB: d4sli_2

Details for d4sli_1

PDB Entry: 4sli (more details), 1.8 Å

PDB Description: leech intramolecular trans-sialidase complexed with 2-propenyl-neu5ac, an inactive substrate analogue

SCOP Domain Sequences for d4sli_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4sli_1 b.29.1.9 (81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora)}
ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns
tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa
nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn
alsdeeliqatgvtty

SCOP Domain Coordinates for d4sli_1:

Click to download the PDB-style file with coordinates for d4sli_1.
(The format of our PDB-style files is described here.)

Timeline for d4sli_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4sli_2