Lineage for d4slia1 (4sli A:81-276)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779920Family b.29.1.9: Leech intramolecular trans-sialidase, N-terminal domain [49968] (1 protein)
    automatically mapped to Pfam PF02973
    automatically mapped to Pfam PF13385
  6. 2779921Protein Leech intramolecular trans-sialidase, N-terminal domain [49969] (1 species)
  7. 2779922Species North american leech (Macrobdella decora) [TaxId:6405] [49970] (5 PDB entries)
  8. 2779926Domain d4slia1: 4sli A:81-276 [24275]
    Other proteins in same PDB: d4slia2
    complexed with cnp

Details for d4slia1

PDB Entry: 4sli (more details), 1.8 Å

PDB Description: leech intramolecular trans-sialidase complexed with 2-propenyl-neu5ac, an inactive substrate analogue
PDB Compounds: (A:) intramolecular trans-sialidase

SCOPe Domain Sequences for d4slia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]}
ipegilmeknnvdiaegqgysldqeagakyvkamtqgtiilsykstsengiqslfsvgns
tagnqdrhfhiyitnsggigielrntdgvfnytldrpasvralykgervfntvalkadaa
nkqcrlfangellatldkdafkfisditgvdnvtlggtkrqgkiaypfggtigdikvysn
alsdeeliqatgvtty

SCOPe Domain Coordinates for d4slia1:

Click to download the PDB-style file with coordinates for d4slia1.
(The format of our PDB-style files is described here.)

Timeline for d4slia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4slia2