![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) ![]() the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity |
![]() | Family a.39.2.0: automated matches [191595] (1 protein) not a true family |
![]() | Protein automated matches [191085] (10 species) not a true protein |
![]() | Species Culex quinquefasciatus [TaxId:7176] [193717] (2 PDB entries) |
![]() | Domain d2l2ca_: 2l2c A: [242744] automated match to d3n7ha_ |
PDB Entry: 2l2c (more details)
SCOPe Domain Sequences for d2l2ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l2ca_ a.39.2.0 (A:) automated matches {Culex quinquefasciatus [TaxId: 7176]} dvtprrdaeypppellealkplhdicakktgvtdeaiiefsdgkihedeklkcymnclfh eakvvddngdvhleklrdslpnsmhdiamhmgkrclypegenlcekafwlhkcwkqadpk hyflv
Timeline for d2l2ca_: