Lineage for d2l2ca_ (2l2c A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325006Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2325099Family a.39.2.0: automated matches [191595] (1 protein)
    not a true family
  6. 2325100Protein automated matches [191085] (10 species)
    not a true protein
  7. 2325123Species Culex quinquefasciatus [TaxId:7176] [193717] (2 PDB entries)
  8. 2325126Domain d2l2ca_: 2l2c A: [242744]
    automated match to d3n7ha_

Details for d2l2ca_

PDB Entry: 2l2c (more details)

PDB Description: NMR Structure of mosquito odorant binding protein bound to MOP pheromone
PDB Compounds: (A:) odorant-binding protein

SCOPe Domain Sequences for d2l2ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l2ca_ a.39.2.0 (A:) automated matches {Culex quinquefasciatus [TaxId: 7176]}
dvtprrdaeypppellealkplhdicakktgvtdeaiiefsdgkihedeklkcymnclfh
eakvvddngdvhleklrdslpnsmhdiamhmgkrclypegenlcekafwlhkcwkqadpk
hyflv

SCOPe Domain Coordinates for d2l2ca_:

Click to download the PDB-style file with coordinates for d2l2ca_.
(The format of our PDB-style files is described here.)

Timeline for d2l2ca_: