SCOPe 2.05: Domain d2l2ca_: 2l2c A:

Lineage for d2l2ca_ (2l2c A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.0: automated matches [191595] (1 protein)
   not a true family

6. Protein automated matches [191085] (7 species)
   not a true protein

7. Species Culex quinquefasciatus [TaxId:7176] [193717] (2 PDB entries)

8. Domain d2l2ca_: 2l2c A: [242744]
   automated match to d3n7ha_

Details for d2l2ca_

PDB Entry: 2l2c

PDB Description: NMR Structure of mosquito odorant binding protein bound to MOP pheromone

PDB Compounds: (A:) odorant-binding protein

SCOPe Domain Sequences for d2l2ca_:

Sequence; same for both SEQRES and ATOM records:

>d2l2ca_ a.39.2.0 (A:) automated matches {Culex quinquefasciatus [TaxId: 7176]}
dvtprrdaeypppellealkplhdicakktgvtdeaiiefsdgkihedeklkcymnclfh
eakvvddngdvhleklrdslpnsmhdiamhmgkrclypegenlcekafwlhkcwkqadpk
hyflv

Timeline for d2l2ca_:

• d2l2ca_ first appeared in SCOPe 2.04
  
• d2l2ca_ appears in SCOPe 2.06
  
• d2l2ca_ appears in the current release, SCOPe 2.08