SCOPe 2.07: Domain d2l2ba_: 2l2b A:

Lineage for d2l2ba_ (2l2b A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins)
   Pfam PF06369

6. Protein Sticholysin II [89268] (1 species)

7. Species Carribean sea anemone (Stoichactis helianthus) [TaxId:6123] [89269] (6 PDB entries)

8. Domain d2l2ba_: 2l2b A: [242743]
   automated match to d1gwya_
   mutant

Details for d2l2ba_

PDB Entry: 2l2b

PDB Description: Structure of StnII-Y111N, a mutant of the sea anemone actinoporin Sticholysin II

PDB Compounds: (A:) Sticholysin-2

SCOPe Domain Sequences for d2l2ba_:

Sequence; same for both SEQRES and ATOM records:

>d2l2ba_ b.97.1.1 (A:) Sticholysin II {Carribean sea anemone (Stoichactis helianthus) [TaxId: 6123]}
alagtiiagasltfqvldkvleelgkvsrkiavgidnesggtwtalnayfrsgttdvilp
efvpntkallysgrkdtgpvatgavaafayymssgntlgvmfsvpfdynwnsnwwdvkiy
sgkrradqgmyedlyygnpyrgdngwheknlgyglrmkgimtsageakmqikisr

Timeline for d2l2ba_:

• d2l2ba_ first appeared in SCOPe 2.04
  
• d2l2ba_ appears in SCOPe 2.06
  
• d2l2ba_ appears in the current release, SCOPe 2.08