Lineage for d2l2aa1 (2l2a A:1508-1647)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416653Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2416654Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2416655Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 2416684Protein Cation-independent mannose-6-phosphate receptor (MIR-receptor) [63821] (3 species)
  7. 2416705Species Human (Homo sapiens) [TaxId:9606] [63822] (5 PDB entries)
  8. 2416712Domain d2l2aa1: 2l2a A:1508-1647 [242742]
    Other proteins in same PDB: d2l2aa2
    automated match to d1gqba_

Details for d2l2aa1

PDB Entry: 2l2a (more details)

PDB Description: Mutated Domain 11 of the Cytoplasmic region of the Cation-independent mannose-6-phosphate receptor
PDB Compounds: (A:) Insulin-like growth factor 2 receptor variant

SCOPe Domain Sequences for d2l2aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l2aa1 b.64.1.1 (A:1508-1647) Cation-independent mannose-6-phosphate receptor (MIR-receptor) {Human (Homo sapiens) [TaxId: 9606]}
mksnehddcqvtnpstghlfdlsslsgragftaaysksgvvymsicgenencppgvgacf
gqtrisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmli
sldkqtctlffswhtplace

SCOPe Domain Coordinates for d2l2aa1:

Click to download the PDB-style file with coordinates for d2l2aa1.
(The format of our PDB-style files is described here.)

Timeline for d2l2aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2l2aa2